PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000610242
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 220aa    MW: 24959.7 Da    PI: 7.296
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000610242genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.22.2e-09954346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT  Ed+l+ +a  ++  +   +W++Ia++++ g+t+k++ +++ +
    MDP0000610242  9 PWTRFEDKLFEQALVRFSDDlpdRWERIAEEVP-GKTPKEVLEHYED 54
                     7*****************99*************.**********976 PP

2Myb_DNA-binding45.22.1e-14102146347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E++l++ + k++G+g+W++I+r +  +Rt+ q+ s+ qky
    MDP0000610242 102 PWTPQEHKLFLIGLKKFGKGDWRSISRNVVVTRTPTQVASHAQKY 146
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.537559IPR017884SANT domain
SMARTSM007173.9E-7658IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-6756IPR009057Homeodomain-like
SuperFamilySSF466891.08E-11864IPR009057Homeodomain-like
CDDcd001676.05E-8956No hitNo description
PfamPF002493.9E-8955IPR001005SANT/Myb domain
PROSITE profilePS5129419.46195151IPR017930Myb domain
SuperFamilySSF466891.22E-1697152IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-1698150IPR006447Myb domain, plants
SMARTSM007171.4E-1099149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-1199145IPR009057Homeodomain-like
CDDcd001673.96E-9102147No hitNo description
PfamPF002493.1E-12102146IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MAQSAASAPW TRFEDKLFEQ ALVRFSDDLP DRWERIAEEV PGKTPKEVLE HYEDLVHDVL  60
EIDSGRVNVP SYADECWDSA GQITFGSKVN KHGEPERKKG TPWTPQEHKL FLIGLKKFGK  120
GDWRSISRNV VVTRTPTQVA SHAQKYFLRQ SSVKKERKRS SIHDITTVES NSVPVPADRN  180
WIPPPADXTH QSPLQQLTPQ SHVPDQGGLL RYQDFGYPM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-16172173RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.150391e-155root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008363219.11e-131PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H79e-61DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM5WIS81e-128M5WIS8_PRUPE; Uncharacterized protein
STRINGGLYMA20G24600.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-70MYB family protein